Anti-HCV1a (D168V), Recombinant (Hepatitis C virus genotype 1a)
Fusion protein corresponding to the serine protease NS3 (a.a.3-181) and cofactor NS4A (a.a.21-32) from Hepatitis C virus genotype 1a (GenBank Accession No. NC_004102) with Asp-to-Val mutation on a.a.168, and N-terminal FLAG-His tag, MW=22.4kD, expressed in an E. coli expression system.
Source
Recombinant protein corresponding to aa3-181 from HCV1a at the N-terminus, with Asp-to-Val mutation on aa 168, an N-terminal FLAG-His-Tag, and a 4aa linker, expressed in E.coli.
Application
Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
AA Sequence
MDYKDDDDKHHHHHHGCVVIVGRIVLSGSGSITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVVFIPVENLETTMRS
Storage and Stability
Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap
Source
Recombinant, E. coli
Form
Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 0.04% Tween 20, 250mM imidazole, 20% glycerol.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 0.04% Tween 20, 250mM imidazole, 20% glycerol.