This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important for spermatogenesis. Four copies of this gene are found on chromosome Y within palindromic duplications; one pair of genes is part of the P2 palindrome and the second pair is part of the P1 palindrome. Each gene contains a 2.4 kb repeat including a 72-bp exon, called the DAZ repeat; the number of DAZ repeats is variable and there are several variations in the sequence of the DAZ repeat. Each copy of the gene also contains a 10.8 kb region that may be amplified; this region includes five exons that encode an RNA recognition motif (RRM) domain. This gene contains three copies of the 10.8 kb repeat. However, no transcripts containing three copies of the RRM domain have been described; thus the RefSeq for this gene contains only two RRM domains.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIG SCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQ KIVGSQIHFHGKKLKLGPAIRKQKLC

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Recombinant protein corresponding to aa21-120 from human DAZ1 with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified

Recognizes human DAZ1.