Mouse Anti-FASLG (Fas Ligand (TNF Superfamily, Member 6), APT1LG1, CD178, CD95L, FASL, TNFSF6, CD95 Ligand, OTTHUMP00000032708, Apoptosis (APO-1) Antigen Ligand 1, Fas Ligand, Tumor Necrosis Factor (Ligand) Superfamily, Member 6) (PE)
The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE).
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
SGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLS HKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSS YLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa172-281 from human FASLG with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Specificity
Recognizes human FASLG.
