Mouse Anti-GCSH (Glycine Cleavage System Protein H (aminomethyl carrier), Lipoic Acid-containing Protein, Mitochondrial glycine cleavage system H-Protein, Part of Mitochondrial Matrix Glycine Cleavage Enzyme Complex of 4 Proteins: H-, L-, P-, and T-Proteins, GCE, NKH) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase; MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM 238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also called nonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGA VRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFA QEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASEL YSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLS NPSELDELMSEEAYEKYIKSIEE
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa1-173 from full-length human GCSH with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Specificity
Recognizes human GCSH.
