Mouse Anti-TAOK2 (TAO Kinase 2, KIAA0881, MAP3K17, PSK, PSK1, TAO1, TAO2) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
TAO kinase 2 (Serine/threonine-protein kinase TAO2) belongs to the MAP kinase family. It activates the JNK MAP kinase pathway through the specific activation of the MAP2Ks MEK3 and MEK6. TAO kinase 2 mediates signaling from carbachol, relaying signals from carbachol through heterotrimeric G proteins to the p38 MAP kinase and ternary complex factors. It alters actin cytoskeletal organization and interacts with microtubules affecting their organization and stability independently of TAO kinase activity.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
ELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQ
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa831-930 from human TAOK2 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Specificity
Recognizes human TAOK2.
