Mouse Anti-AGPAT1 (1-acylglycerol-3-Phosphate O-Acyltransferase 1 (Lysophosphatidic Acid Acyltransferase, alpha), 1-AGPAT1, G15, LPAAT-alpha, LPAATA, MGC4007, MGC5423)
1-acylglycerol-3-Phosphate O-Acyltransferase 1 (Lysophosphatidic Acid Acyltransferase, alpha), 1-AGPAT1, G15, LPAAT-alpha, LPAATA, MGC4007, MGC5423
This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
AGPAT1 (NP_006402.1, 1aa-283aa) full-length human protein.
Form
Supplied as a liquid. No preservative added.
Specificity
Recognizes human AGPAT1.