Mouse Anti-C2orf28 (Chromosome 2 Open Reading Frame 28, APR--3, APR-3, APR3, HSPC013, PRO240, p18)
Chromosome 2 Open Reading Frame 28, APR--3, APR-3, APR3, HSPC013, PRO240, p18
This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
C2orf28 (NP_057169, 1aa-171aa) full-length human protein.
Form
Supplied as a liquid. No preservative added.
Specificity
Recognizes human C2orf28.