Mouse Anti-CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A)
Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A
Mouse monoclonal antibody raised against a partial recombinant CAND1.
Applications
Suitable for use in ELISA, Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
Storage and Stability
May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.
Immunogen
CAND1 (NP_060918, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Specificity
Recognizes human CAND1.
