Mouse Anti-DNAJC10 (DnaJ (Hsp40) Homolog, Subfamily C, Member 10, DKFZp434J1813, ERdj5, JPDI, MGC104194)
DnaJ (Hsp40) Homolog, Subfamily C, Member 10, DKFZp434J1813, ERdj5, JPDI, MGC104194
Mouse monoclonal antibody raised against a partial recombinant DNAJC10.
Applications
Suitable for use in ELISA, Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
DNAJC10 (NP_061854, 688aa-793aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid.
Specificity
Recognizes human DNAJC10.
