Mouse Anti-DNAJC15 (DnaJ (Hsp40) Homolog, Subfamily C, Member 15, DNAJD1, HSD18, MCJ)
DnaJ (Hsp40) Homolog, Subfamily C, Member 15, DNAJD1, HSD18, MCJ
Mouse polyclonal antibody raised against a full-length human DNAJC15 protein.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
DNAJC15 (NP_037370, 1aa-150aa) full-length human protein.
Form
Supplied as a liquid in PBS, pH 7.4.
Specificity
Recognizes human DNAJC15.
