Mouse Anti-EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2, 4E-LP, 4EHP, EIF4EL3, IF4e)
Eukaryotic Translation Initiation Factor 4E Family Member 2, 4E-LP, 4EHP, EIF4EL3, IF4e
Mouse polyclonal antibody raised against a full-length human EIF4E2 protein.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
EIF4E2 (AAH21690.1, 1aa-245aa) full-length human protein.
Form
Supplied as a liquid. No preservative added.
Specificity
Recognizes human EIF4E2.