Mouse Anti-NUCKS1 (Nuclear Casein Kinase and Cyclin-Dependent Kinase Substrate 1, FLJ21480, FLJ32016, FLJ38536, JC7, NUCKS)
Nuclear Casein Kinase and Cyclin-Dependent Kinase Substrate 1, FLJ21480, FLJ32016, FLJ38536, JC7, NUCKS
Mouse monoclonal antibody raised against a full-length recombinant NUCKS1.
Applications
Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MSRPVRNRKVVDYSQFQESDDADEDYGRDSGPPTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDDSHSAEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKEKTPSPKEEDEEPESPPEKKTSTSPPPEKSGDEGSEDEAPSGED
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full-length recombinant protein corresponding to aa1-243 of human NUCKS1 with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Specificity
Recognizes human NUCKS1.