Mouse Anti-RAB43 (RAB43, Member RAS Oncogene Family, ISY1, MGC90481, RAB11B, RAB41)
RAB43, Member RAS Oncogene Family, ISY1, MGC90481, RAB11B, RAB41
Mouse polyclonal antibody raised against a full-length human RAB43 protein.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFSEKSPDHIQLNSKDIGEGWGCGC
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
RAB43 (NP_940892, 1aa-212aa) full-length human protein.
Form
Supplied as a liquid. No preservative added.
Specificity
Recognizes human RAB43.
