Mouse Anti-RASGEF1B (RasGEF Domain Family, Member 1B, FLJ31695, GPIG4, MGC46251)
RasGEF Domain Family, Member 1B, FLJ31695, GPIG4, MGC46251
Mouse polyclonal antibody raised against a full-length human RASGEF1B protein.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDRTYIFTFLLSSRLFMHPYELMAKVCHLCVEHQRLSDPDSDKNQMRKIAPKILQLLTEWTETFPYDFRDERMMRNLKDLAHRIASGEEVGNLNLARLLEFPGRAWVGNGAELCILISTASSLFCLWASPPHHILVYLVCQVRMIIPSHFKGI
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
RASGEF1B (AAH36784, 1aa-210aa) full-length human protein.
Form
Supplied as a liquid. No preservative added.
Specificity
Recognizes human RASGEF1B.
