Mouse Anti-RBMS2 (RNA Binding Motif, Single Stranded Interacting Protein 2, FLJ39093, FLJ40023, FLJ43262, SCR3) (APC)
RNA Binding Motif, Single Stranded Interacting Protein 2, FLJ39093, FLJ40023, FLJ43262, SCR3
The protein encoded by this gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. The RBMS proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. This protein was isolated by phenotypic complementation of cdc2 and cdc13 mutants of yeast and is thought to suppress cdc2 and cdc13 mutants through the induction of translation of cdc2. [provided by RefSeq
Applications
Suitable for use in Immunofluorescence, FLISA, Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
HHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLSSTGTYMPTMouse monoclonal antibody raised against a partial recombinant RBMS2.MQGAYISQYTPVPSSSVSVEESSGQQNQVAVDAPSEHGVYSFQFN*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
RBMS2 (NP_002889, 308aa-407aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Specificity
Recognizes RBMS2.
