Mouse Anti-SLC9A9 (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 9, FLJ35613, NHE9, Nbla00118) (PE)
Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 9, FLJ35613, NHE9, Nbla00118
Mouse monoclonal antibody raised against a partial recombinant SLC9A9.
Applications
Suitable for use in FLISA, Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
APTDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAILEK
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
SLC9A9 (NP_775924.1, 71aa-126aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Specificity
Recognizes SLC9A9.
