Mouse Anti-SOX21 (SRY (Sex Determining Region Y)-Box 21, SOX25) (MaxLight 550)
SRY (Sex Determining Region Y)-Box 21, SOX25
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM
Applications
Suitable for use in FLISA, Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
KFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKMouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.ARVFFPQSMouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.Mouse monoclonal antibody raised against a full length recombinant SOX21.AGSPYSLLDLGSKMAEISS
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
SOX21 (NP_009015, 91aa-184aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Specificity
Recognizes SOX21.
