253332-PE
Clone Type
MonoclonalHost
MouseConjugate
PEIsotype
IgG1,kClone Number
1C4Grade
PurifiedApplications
E IF WBAccession #
NP_068706Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
Mouse Anti-USP9X (Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM) (PE)
Ubiquitin Specific Peptidase 9, X-Linked, DFFRX, FAF, FAM
This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Applications
Suitable for use in Immunofluorescence, Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
USP9X (NP_068706, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Specificity
Recognizes USP9X.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1.Role of Ku70 in deubiquitination of Mcl-1 and suppression of apoptosis.Wang B, Xie M, Li R, Owonikoko TK, Ramalingam SS, Khuri FR, Curran WJ, Wang Y, Deng XCell Death Differ. 2014 Apr 25. doi: 10.1038/cdd.2014.42. 2.Deubiquitinase USP9x Confers Radioresistance through Stabilization of Mcl-1.|Trivigno D, Essmann F, Huber SM, Rudner J.Neoplasia. 2012 Oct;14(10):893-904. 3.Mcl-1 phosphorylation defines ABT-737 resistance that can be overcome by increased NOXA expression in leukemic B-cells. Mazumder S, Choudhary GS, Al-Harbi S, Almasan A.Cancer Res. 2012 Apr 23. 4.The Bcl-xL inhibitor, ABT-737, efficiently induces apoptosis and suppresses growth of hepatoma cells in combination with sorafenib.Hikita H, Takehara T, Shimizu S, Kodama T, Shigekawa M, Iwase K, Hosui A, Miyagi T, Tatsumi T, Ishida H, Li W, Kanto T, Hiramatsu N, Hayashi N.Hepatology (2010) DOI: 10.1002/ hep.23836USBio References
No references available