Rabbit Anti-FOXA3 (Hepatocyte Nuclear Factor 3-gamma, Fork Head-Related Protein FKH H3, Foxa-3, Hepatocyte Nuclear Factor 3-gamma, HNF 3G, HNF3G, HNF-3G, HNF3G, TCF3G, Hnf3g, Tcf-3g, Tcf3g, HNF-3-gamma, TCF-3G)
Hepatocyte nuclear factor 3-gamma (HNF-3G), also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), is a protein that in humans is encoded by the FOXA3 gene. This gene is mapped to 19q13.32. HNF-3G is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability
Lyophilized powder may be stored at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Immunogen
Synthetic peptide corresponding to aa291-324, ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF, of human FOXA3 at C-terminal., different from the related mouse and rat sequences by 3aa.
Form
Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Purity
Purified by immunoaffinity chromatography.
Specificity
Recognizes human FOXA3. Species Crossreactivity: mouse and rat
