Rabbit Anti-ZP1 (Zona Pellucida Sperm-Binding Protein 1, Zp-1, Zp 1)
Zona pellucida sperm-binding protein 1 (ZP1) is a protein that belopngs to the mammalian zona pellucida. The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. Zp1 ensures the structural integrity of the zona pellucida. Mutations in this gene are a cause of oocyte maturation defect and infertility. And this gene is mapped to chromosome 11q12.2.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability
Lyophilized powder may be stored at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Immunogen
Synthetic peptide corresponding to aa102-139, HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD, of human ZP1 at N-terminal, different from the related mouse sequence by 4aa and from the related rat sequence by 5aa.
Form
Supplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml.
Purity
Purified by immunoaffinity chromatography.
Specificity
Recognizes human ZP1. Species Crossreactivity: rat
