377402
Clone Type
PolyclonalHost
RabbitSource
HumanIsotype
IgGGrade
Affinity PurifiedApplications
IHC WBCrossreactivity
Hu Mo RtGene ID
3146Gene #
HMGB1Shipping Temp
Blue IceStorage Temp
-20°CRabbit Anti-HMGB1 (High Mobility Group Protein B1)
High mobility group protein B1, High mobility group protein 1, HMG-1, HMGB1, HMG1
High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.
Applications
Suitable for use in Western Blot, Immunohistohemistry. Other applications not tested.
Recommended Dilution
Western Blot: 0.1-0.5ug/ml Immunohistochemistry (paraffin): 0.5-1ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability
Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Immunogen
Synthetic peptide corresponding to aa124-154, DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK from human HMGB1 at C-terminal.
Form
Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
Purity
Purified by immunoaffinity chromatography.
Specificity
Recognizes human HMGB1. Species Crossreactivity: mouse and rat
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
Junli Zhaoa, 1, Yi Wanga, 1, Cenglin Xua, 1, Keyue Liub, 1, Ying Wanga, Liying Chena, Xiaohua Wuc, Feng Gaoc Brain, Behavior, and Immunity Available online 3 February 2017 Therapeutic Potential of an Anti-High Mobility Group Box-1 Monoclonal Antibody in EpilepsyUSBio References
No references available