Rabbit Anti-AAMDC (Protein RGD1561459 Ensembl ENSRNOP00000016783)
RGD1561459
The function of this protein remains unknown.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Synthetic peptide located within the following region: IASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVK of rat AAMDC.|Species sequence homology: bovine, canine, guinea pig, equine, human, mouse, rabbit (100%); zebrafish (85%)
Form
Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Purity
Purified by affinity chromatography.
Specificity
Recognizes rat AAMDC.