Rabbit Anti-EMX2 (Homeobox Protein EMX2)
The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 along with EMX2 is related to the 'empty spiracles' gene expressed in the developing Drosophila head.
Applications
Suitable for use in Immunohistochemistry and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Synthetic peptide located within the following region of human EMX2: ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG. Species sequence homology: bovine: 100%; canine: 100%; guinea pig: 100%; mouse: 100%; rabbit: 100%; rat: 100%; zebrafish: 92%
Form
Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Purity
Purified by affinity chromatography.
Specificity
Recognizes human EMX2.
