Rabbit Anti-SLC38A2 (Sodium-Coupled Neutral Amino Acid Transporter 2, Solute Carrier Family 38, Member 2)
ATA2, KIAA1382, PRO1068, SAT2, SNAT2
Under hypertonic conditions the induction of SLC38A2/SNAT2 leads to the stimulation of transport system A and to the increase in the cell content of amino acids. Its amino acid response element, along with a nearby conserved CAAT box, has enhancer activity in that it functions in an orientation and position independent manner, and it confers regulated transcription to a heterologous promoter.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Western Blot: 1ug/ml Optimal dilutions to be determined by the researcher.
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Synthetic peptide located within the following region: AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI corresponding to the N-terminal region of human SLC38A2.
Form
Supplied as a liquid in PBS, 2% sucrose, 0.09% sodium azide.
Purity
Purified by affinity chromatography.
Specificity
Recognizes human SLC38A2.