Rabbit Anti-CHODL
C21orf68, MT75, PRED12
This gene encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathogens. This protein localizes predominantly to the perinuclear region. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Western Blot: 1:500-1:2000 Optimal dilutions to be determined by the researcher.
AA Sequence
YRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEAGIIPNLIYVVIPTIPLLL
Positive Control
Mouse testis, rat spleen
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Recombinant fusion protein containing a sequence corresponding to aa110-210 of human CHODL (NP_001191103.1).
Form
Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Purity
Purified by affinity chromatography.
Specificity
Recognizes human CHODL. Species Crossreactivity: mouse and rat
