Mouse Anti-CCR4-Not Transcription Complex, Subunit 2 (CNOT2, CDC36, HSPC131, Negative Regulator of Transcription Subunit 2 Homolog, NOT2H)
The CCR4-Not complex is a highly conserved regulator of mRNA metabolism.
Applications
Suitable for use in Western Blot and Dot Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to human CCR4-Not Transcription Complex, Subunit 2 corresponding to amino acids within the internal portion of the protein. Immunogen sequence: FPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLP
Form
Supplied as a liquid in PBS, pH 7.4, 1% BSA, 0.05% sodium azide.
Purity
Purified by Protein G affinity chromatography from hybridoma culture supernatant
Specificity
Recognizes human CCR4-Not Transcription Complex, Subunit 2.
