Rabbit Anti-Interleukin 21 Receptor (IL-21R)
A novel cytokine related to IL2 and IL15 was recently identified and designated IL-21 (1). The receptor for IL-21 (IL-21R, also termed NILR for novel Interleukin receptor) is a new member of the class I cytokine receptor family (1,2). IL-21R forms a complex with the common cytokine receptor gamma chain, gammac, and mediates IL-21 signaling (3,4). Both IL-21R and the gammac are necessary for the IL-21 function. IL-21 and its receptor activate JAK-STAT signaling pathway. IL-21R is expressed in spleen, thymus, natural killer (NK), T and B cell lines. IL-21 plays a role in the proliferation and maturation of NK, B and T cell populations.
Applications
Suitable for use in ELISA, Flow Cytometry and Immunohistochemistry. Other applications not tested.
Recommended Dilutions
ELISA: 1:50,000 Immunohistochemistry: 1:250 Flow Cytometry: 1:25 Optimal dilutions to be determined by the researcher.
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Synthetic peptide corresponding to 35-65 residues, CVLETRSPNPSILSLTWQDEYEELQDQETF, of N-terminus of mouse IL-21 receptor.
Form
Supplied as a liquid in PBS, 1mg/ml BSA, 0.09% sodium azide.
Purity
Purified by affinity chromatography.
Specificity
Recognizes N-terminus of mouse IL-21 receptor.