Mouse Anti-NDST1 (Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 1, Glucosaminyl N-deacetylase/N-sulfotransferase 1, NDST-1, [Heparan Sulfate]-Glucosamine N-sulfotransferase 1, HSNST 1, N-heparan Sulfate Sulfotransferase 1, N-HSST 1, HSST, HSST1) (Azide Free) (HRP)
NDST1 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands, thereby playing a role in inflammatory response.
Applications
Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested.
Recommended Dilutions
Western Blot: 1:500-1:1000 Immunohistochemistry (formalin-fixed, paraffin-embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI
Positive Control
Human small intestine, A549 cells.
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa38-136 of human NDST1 (NP_001534) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by ammonium sulfate precipitation.
Specificity
Recognizes human NDST1.