The PACAP receptor type 1, a member of the vasoactive intestinal polypeptide subfamily, binds the hormone pituitary adenylate cyclase activating polypeptide (PACAP) with high affinity. PACAP is involved in stimulating the secretion of insulin, catecholamines, ACTH, and growth hormone. Additionally, PACAP appears to function as a neuromodulator/neurotransmitter in the central and peripheral nervous systems. Two start codons are reported in literature, one (nt 74-76) results in a 525aa protein with a signal peptide of 77aa encoded by nt 74-304 and the second (nt 245-247) initiates a 468aa protein with a signal peptide of 20aa encoded by nt 245-304. The efficiency of these two start codons is not known. PACAP receptor type 1 expression has been documented in adipose, adrenal, bone, brain, colon, ganglion, heart, lung, ovary, pancreas, placenta, spleen, and uterus. ESTs have been isolated from brain and nerve libraries.

Suitable for use in FLISA and Western Blot. Other applications have not been tested.

Optimal dilutions to be determined by the researcher.

Amino Acid Sequence: MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant protein corresponding to aa21-120 from human PACAP Type 1 Receptor with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified

Recognizes human PACAP Type 1 Receptor.