Rabbit Anti-TIP 39 (Not for Export EU)
Applications
Suitable for use in ELISA, Immunohistochemistry and RIA. Other applications not tested.
Recommended Dilutions
ELISA: 1:4000 RIA: 1:2000 Immunohistochemistry (Paraffin): 1:100 Optimal dilutions to be determined by the researcher.
Storage and Stability
Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Immunogen
Synthetic peptide corresponding to aa62-100, SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP of human TIP 39, conjugated to KLH.
Form
Supplied as a lyophilized powder in PBS pH 7.2. Reconstitute with 100ul sterile ddH2O.
Specificity
Recognizes human TIP 39 (aa62-100). Species Crossreactivity: bovine and canine.
