Mouse Anti-USP21 (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
USP21 is a ubiquitin-specific protease, an enzyme that removes ubiquitin from ubiquitinated proteins. The encoded protein belongs to the C19 peptidase family, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. This protein has been reported to be capable of removing NEDD8 from NEDD8 conjugates.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa 466-566 from human USP21 (NP_036607) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Specificity
Recognizes human USP21.