Technical Data

127949-FITC
Grade
Affinity Purified
Accession Number
NM_001003681
EU Commodity Code
30021010
Shipping Temp
Blue Ice
Storage Temp
-20°C
Notes
Preservative Free
BSA Free
HMG2L1 (HMG Domain-containing Protein 4, HMG Box-containing Protein 4, High Mobility Group Protein 2-like 1, Protein HMGBCG, HMGXB4, HMGBCG) (FITC)

Negatively regulates Wnt/beta-catenin signaling during development.

Applications
Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKK
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.

Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.

References
No references available
USBio References
No references available
United States Biological | 4 Technology Way | Salem, MA 01970
Phone 800-520-3011 | Fax 978-594-8052 | Website www.usbio.net