123312-Biotin
Conjugate
BiotinSpecificity
Recognizes human ANAPC2.Source Antibody
humanPurity
Purified by Protein A affinity chromatography.Accession Number
NM_013366, NP_037498EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
ANAPC2 (Anaphase-promoting Complex Subunit 2, Cyclosome Subunit 2, APC2, KIAA1406, RP11-350O14.5) (Biotin)
APC2 (molecular weight 92kD) is a cullin-related subunit of the anaphase-promoting complex (APC), or cyclosome. APC2 specifically interacts with APC11, another APC subunit.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
EEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS*
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
