124968
Specificity
Recognizes human CHRAC1.Source Antibody
humanPurity
Purified by Protein A affinity chromatography.Accession Number
BC015891, AAH15891EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
-20°CCHRAC1 (Chromatin Accessibility Complex Protein 1, CHRAC-1, Chromatin Accessibility Complex 15kD Protein, CHRAC-15, HuCHRAC15, DNA Polymerase Epsilon Subunit p15, CHRAC15)
CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sqeuence
MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
