127949-APC
Conjugate
APCSpecificity
Recognizes human HMG2L1.Source Antibody
humanPurity
Purified by Protein A affinity chromatography.Accession Number
NM_001003681EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
BSA Free
HMG2L1 (HMG Domain-containing Protein 4, HMG Box-containing Protein 4, High Mobility Group Protein 2-like 1, Protein HMGBCG, HMGXB4, HMGBCG) (APC)
Negatively regulates Wnt/beta-catenin signaling during development.
Applications
Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTHKK
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.