Technical Data

130364-HRP
Conjugate
HRP
Specificity
Recognizes human NBN.
Source Antibody
human
Purity
Purified by Protein A affinity chromatography.
Accession Number
NM_002485, NP_002476
EU Commodity Code
30021010
Shipping Temp
Blue Ice
Storage Temp
-20°C
Notes
Preservative Free
BSA Free
Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (HRP)

Mutations in this Nibrin (NBN) are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation.

Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.

Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.

References
No references available
USBio References
No references available
United States Biological | 4 Technology Way | Salem, MA 01970
Phone 800-520-3011 | Fax 978-594-8052 | Website www.usbio.net