132486-ML490
Conjugate
MaxLight™490Specificity
Recognizes human REXO2.Source Antibody
humanPurity
Purified by Protein A affinity chromatography.Accession Number
NM_015523EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
REXO2 (RNA Exonuclease 2 Homolog, REX2, CGI-114, Oligoribonuclease, Mitochondrial, RFN, Small Fragment Nuclease , SFN, SMFN) (MaxLight 490)
EC=3.1.-.-
MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
FLISA: 1ng/ml Optimal dilutions to be determined by the researcher.
AA Sequence
HGRSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFY*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
