135497-HRP
Conjugate
HRPSpecificity
Recognizes human ZAK.Source Antibody
humanPurity
Purified by Protein A affinity chromatography.Accession Number
BC001401, AAH01401EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
MLTK (Mitogen-activated Protein Kinase Kinase Kinase MLT, Human Cervical Cancer Suppressor Gene 4 Protein, HCCS4, HCCS-4, Leucine Zipper- and Sterile alpha Motif-containing Kinase, MLK-like Mitogen-activated Protein Triple Kinase, Mixed Lineage Kinase-related Kinase, MLK-related Kinase, MRK, Sterile alpha Motif- and Leucine Zipper-containing Kinase AZK, ZAK) (HRP)
EC=2.7.11.25
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLLPLAARMSEESYFESKTEESNSAEMSCQITATSNGEGHGMNPSLQAMMLMGFGDIFSMNKAGAVMHSGMQINMQAKQNSSKTTSKRRGKKVNMALGFSDFDLSEGDDDDDDDGEEEDNDMDNSE
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.