245065-FITC
Conjugate
FITCSpecificity
Recognizes human CTNNBIP1.Purity
PurifiedAccession Number
NP_064633EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
CTNNBIP1 (Catenin, beta Interacting Protein 1, ICAT, MGC15093) (FITC)
Catenin, beta Interacting Protein 1, ICAT, MGC15093
The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Applications
Suitable for use in Western Blot and FLISA . Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.