246928-ML650
Conjugate
MaxLight™650Specificity
Recognizes HBB.Purity
PurifiedAccession Number
AAH07075EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
HBB (Hemoglobin, beta, CD113t-C) (MaxLight 650)
Hemoglobin, beta, CD113t-C
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1.A novel transgenic mouse model produced from lentiviral germline integration for the study of beta-thalassemia gene therapy.Li W, Xie S, Guo X, Gong X, Wang S, Lin D, Zhang J, Ren Z, Huang S, Zeng F, Zeng Y.Haematologica. 2008 Mar;93(3):356-62. Epub 2008 Feb 11. 2.Restoration of the balanced {alpha}/{beta}-globin gene expression in {beta}654-thalassemia mice using combined RNAi and antisense RNA approach.Xie SY, Ren ZR, Zhang JZ, Guo XB, Wang QX, Wang S, Lin D, Gong XL, Li W, Huang SZ, Zeng F, Zeng YT.Hum Mol Genet. 2007 Nov 1;16(21):2616-25. Epub 2007 Aug 22.USBio References
No references available