246949-ML650
Conjugate
MaxLight™650Specificity
Recognizes HCLS1.Purity
PurifiedAccession Number
AAH16758EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
HCLS1 (Hematopoietic Cell-Specific Lyn Substrate 1, CTTNL, HS1) (MaxLight 650)
Hematopoietic Cell-Specific Lyn Substrate 1, CTTNL, HS1
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Mouse monoclonal antibody raised against a partial recombinant HCLS1.
Applications
Suitable for use in Immunofluorescence, Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Intended for research use only. Not for use in human, therapeutic, or diagnostic applications.
References
1.Endothelial cell dysfunction and cytoskeletal changes associated with repression of p16(INK4a) during immortalization.Kan CY, Wen VW, Pasquier E, Jankowski K, Chang M, Richards LA, Kavallaris M, Mackenzie KL.Oncogene. 2012 Feb 6. doi: 10.1038/onc.2011.645. [Epub ahead of print]USBio References
No references available