129617-ML650
Grade
Affinity PurifiedPurity
Purified by Protein A affinity chromatography.Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.Conjugate
MaxLight™650Specificity
Recognizes human MGAT3.EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
MGAT3 (Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase, GGNT3, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III, N-acetylglucosaminyltransferase III, GlcNAc-T III, GNT-III, FLJ43371, MGC141943, MGC142278) (MaxLight 650)
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. MGAT3 (N-acetylglucosaminyltransferase III) transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Expression of this gene may be controlled by a multiple-promoter system.
Applications
Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
LVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
