129647-FITC
Grade
Affinity PurifiedPurity
Purified by Protein A affinity chromatography.Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).Conjugate
FITCSpecificity
Recognizes human MGC42638.EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
-20°CNotes
Preservative Free
BSA Free
UBE2DNL (MGC42638, Putative Ubiquitin-conjugating Enzyme E2 D2-like Protein, Ubiquitin Carrier Protein D2-like, Ubiquitin-conjugating Enzyme E2D N-terminal-like, Ubiquitin-protein Ligase D2-like, UBE2D2L) (FITC)
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MALKLIHKEFLELARDPQPHCSAGPVWDDMLHWQATITRPNDSSYLGGVFFLKFPSDYLFKPPKIKFTNGIYHQR*
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.