129647-ML550
Grade
Affinity PurifiedPurity
Purified by Protein A affinity chromatography.Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.Conjugate
MaxLight™550Specificity
Recognizes human MGC42638.EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNotes
Preservative Free
UBE2DNL (MGC42638, Putative Ubiquitin-conjugating Enzyme E2 D2-like Protein, Ubiquitin Carrier Protein D2-like, Ubiquitin-conjugating Enzyme E2D N-terminal-like, Ubiquitin-protein Ligase D2-like, UBE2D2L) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Applications
Suitable for use in FLISA. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
MALKLIHKEFLELARDPQPHCSAGPVWDDMLHWQATITRPNDSSYLGGVFFLKFPSDYLFKPPKIKFTNGIYHQR*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.