134370
Grade
Affinity PurifiedPurity
Purified by Protein A affinity chromatography.Form
Supplied as a liquid in PBS, pH 7.2.Specificity
Recognizes human TFEC.EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
-20°CTranscription Factor EC (TFEC, TFE-C, TCFEC, Class E Basic Helix-loop-helix Protein 34, bHLHe34, Transcription Factor EC-like, TFECL, TFEC-L, hTFEC-L)
Applications
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWHLSGSILDVYSGEQGISPINMGLTSASCPS*
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.