124489-APC
Grade
Affinity PurifiedConjugate
APCSpecificity
Recognizes human CCR5. Species Crossreactivity: rat.Applications
WBAccession Number
NM_000579, XP_001125981.1EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeBSA Free
YesNotes
BSA Free
CCR5 (C-C Chemokine Receptor Type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 Fusion Coreceptor, CD195, CMKBR5) (APC)
CD195 is a 45kD glycoprotein also known as CCR5. CD195 acts as a receptor for a number of chemokines including RANTES and eotaxin and also serves as a co-receptor for the entry of HIV into cells. CD195 is expressed by a subset of T lymphocytes and by monocytes.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.