126312-ML490
Grade
Affinity PurifiedConjugate
MaxLight™490Specificity
Recognizes human EMX2.Applications
FLISA IHCAccession Number
NM_004098, NP_004089EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezePreservative Free
YesNotes
Preservative Free
EMX2 (Homeobox Protein EMX2, Empty Spiracles Homolog 2, Empty Spiracles-like Protein 2) (MaxLight 490)
MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Applications
Suitable for use in FLISA and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
