127749-FITC
Grade
Affinity PurifiedConjugate
FITCSpecificity
Recognizes human HCLS1.Applications
FLISA IHC WBAccession Number
BC016758, AAH16758EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
-20°CBSA Free
YesPreservative Free
YesNotes
Preservative Free
BSA Free
HCLS1 (Hematopoietic Lineage Cell-specific Protein, Hematopoietic Cell-specific LYN Substrate 1, LckBP1, p75, HS1) (FITC)
Substrate of the antigen receptor-coupled tyrosine kinase. Plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. May also be involved in the regulation of gene expression.
Applications
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
Storage and Stability
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
