130102-ML490
Grade
Affinity PurifiedConjugate
MaxLight™490Specificity
Recognizes human MYST2.Applications
FLISA WBAccession Number
BC032640, AAH32640EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezePreservative Free
YesNotes
Preservative Free
KAT7 (Histone Acetyltransferase KAT7, Histone Acetyltransferase Binding to ORC1, Lysine Acetyltransferase 7, MOZ, YBF2/SAS3, SAS2 and TIP60 Protein 2, MYST-2, HBO1, HBOa, MYST2) (MaxLight 490)
MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Through chromatin acetylation it may regulate DNA replication and act as a coactivator of TP53-dependent transcription. Specifically represses AR-mediated transcription.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
