130373-ML550
Grade
Affinity PurifiedConjugate
MaxLight™550Specificity
Recognizes human NIFUN.Applications
FLISA IF WBAccession Number
BC011906, AAH11906EU Commodity Code
30021010Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezePreservative Free
YesNotes
Preservative Free
NIFUN (Iron-Sulfur Cluster Assembly Enzyme ISCU, Mitochondrial, NifU-like N-Terminal Domain-Containing Protein, NifU-like Protein, ISCU) (MaxLight 550)
MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Involved in the assembly or repair of the [Fe-S] clusters present in iron-sulfur proteins. Binds iron.
Applications
Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
